SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T0DKH3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T0DKH3
Domain Number 1 Region: 61-141
Classification Level Classification E-value
Superfamily Clostridium neurotoxins, "coiled-coil" domain 0.0000111
Family Clostridium neurotoxins, "coiled-coil" domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) T0DKH3
Sequence length 197
Comment (tr|T0DKH3|T0DKH3_9PROT) Uncharacterized protein {ECO:0000313|EMBL:EPZ51832.1} KW=Complete proteome; Reference proteome OX=1201290 OS=Bacteriovorax sp. BAL6_X. GN=M902_2349 OC=Bacteriovoracaceae; Bacteriovorax.
Sequence
MGTSVSQPSPTASSEGGNEWNDVKDSIRNFTNIENITSKLVVAYESQYDASASEVIVDRG
VESVITSLERQISANTSSEEKVLNMMLASRKELAINNCNSFFAEIALSAASTALMSNNAD
VMKKFASNYAKRIIDYIASRDLPMNIGTKGLTNLGSLDRVLSSSEQYFESKLNQSQTGTI
TEKLKSIFTQSGEVTDE
Download sequence
Identical sequences T0DKH3
WP_021265875.1.87565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]