SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T0Q881 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T0Q881
Domain Number 1 Region: 258-380
Classification Level Classification E-value
Superfamily Chaperone J-domain 6.15e-25
Family Chaperone J-domain 0.00015
Further Details:      
 
Domain Number 2 Region: 3-86
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000992
Family DIX domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) T0Q881
Sequence length 384
Comment (tr|T0Q881|T0Q881_9STRA) Uncharacterized protein {ECO:0000313|EMBL:EQC29680.1} KW=Complete proteome; Reference proteome OX=1156394 OS=Saprolegnia diclina VS20. GN=SDRG_12681 OC=Saprolegnia.
Sequence
MAETWAFYYLQAEDGEDRSHPNAFRIPKSGELTLGDVHAHFPLGSPAGFHFRFRLNHGET
FYWIDVTAPTATVPLVNGRVICKVLRHVRPTKKGLVLQRKPVYSMATDAAKPRDAKRPTK
YSDEPKPSARPASAPPKQEVKPKESSESFEDFLAGAPKPAPAAPVDLMGGGSTWTAPKAA
PKAAPVRRPSPPPVAASAPPKDFNDDCNQTVGPVSLADMAKHEVSADGTNVYNPDLVDKS
TKSADVREAMEQREQQKAADIERARLELLARDQAKTQLEAAKANAVGALGPKLKNWAEDN
GRKKNIRTLISTMHQILWPDAKWTEVNMGKLLTPNDVKKQYRRAIMVVHPDKAGGRTAEQ
LVIAERIFDAVNSAWDEFARTEMK
Download sequence
Identical sequences T0Q881
XP_008616984.1.67053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]