SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1EEF1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T1EEF1
Domain Number 1 Region: 5-217
Classification Level Classification E-value
Superfamily Kelch motif 5.62e-45
Family Kelch motif 0.00013
Further Details:      
 
Weak hits

Sequence:  T1EEF1
Domain Number - Region: 259-286
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 0.0498
Family Vertebrate phospholipase A2 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) T1EEF1
Sequence length 291
Comment (tr|T1EEF1|T1EEF1_HELRO) Uncharacterized protein {ECO:0000313|EMBL:ESN92673.1, ECO:0000313|EnsemblMetazoa:HelroP108080} KW=Complete proteome; Reference proteome OX=6412 OS=Helobdella robusta (Californian leech). GN=HELRODRAFT_108080 OC=Rhynchobdellida; Glossiphoniidae; Helobdella.
Sequence
MEYKTCMVDNCLYVAGGNRYTSLVTNEVYVYKPVPAIWTKCCSMYVPRKDFYFGELDGHL
YAVSGRTFITRTPTVEKYIPQKNRWAMLAPLPVDSSRPAGCACNGLLYLSGGLTESGTSN
RVWRYNPDLNNWTEMARMLSSRAEHIMTCIGNKVFAIGGSICEYQFFAWNDVMSGEIYDC
EANQWTNLLTLKMSVLNKAFFTSDNCIYIIGQELNFRHHFFNTFVQKINLRMYLDKITAS
GNHDSNTNDAASNAAGNNNNDDGCQVFRCEVNNRLDYCFFGIVNSSKLASE
Download sequence
Identical sequences T1EEF1
jgi|Helro1|108080 XP_009028982.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]