SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1EG70 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  T1EG70
Domain Number - Region: 84-208
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000565
Family Growth factor receptor domain 0.0062
Further Details:      
 
Domain Number - Region: 396-516
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00706
Family Growth factor receptor domain 0.003
Further Details:      
 
Domain Number - Region: 218-342
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0143
Family Growth factor receptor domain 0.0074
Further Details:      
 
Domain Number - Region: 579-622
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0728
Family Laminin-type module 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) T1EG70
Sequence length 795
Comment (tr|T1EG70|T1EG70_HELRO) Uncharacterized protein {ECO:0000313|EMBL:ESN94109.1, ECO:0000313|EnsemblMetazoa:HelroP115175} KW=Complete proteome; Reference proteome OX=6412 OS=Helobdella robusta (Californian leech). GN=HELRODRAFT_115175 OC=Rhynchobdellida; Glossiphoniidae; Helobdella.
Sequence
MVHDIEPEKFTNMTNSPQCPVGTFGLRCRLNCDACANGGECNKEMNACECSEGWAGVLCA
SPCPEGFYGKGCNEVCKCKNEGKCDHVTGSCTCPLGVSGEFCRDGCPAGFYGEDCKRRCQ
QCWSGRCHKRHGFCICPPGFFSHNCQLTCPAWSYGSNCLKGCRCVMENSLACDKTNGSCQ
CKPGYRGDMCQDVCEDGTWGEGCAFKCSCASLSSLTSSSCDHVTGQCAAKCPAGWQGENC
DIPCSSGYYGLECREVCACSGSPCDIQTGACHCMPGRIGITCEQDCPPNHWGVGCSKMCE
CENEALCDVISGHCVCPAGYFGRRCEEVCPHGTYGMNCERECECMNGATCNHVTGQCTCP
LAWTGQLCDRPCPPGKHGMNCMHQCTCKNSAECDAVTGKCLCTSGFSGEDCSEKCPQGTY
GQGCQHQCTCTNSATCDHISGTCLCIAGWHGLHCEKKCPEGFYGDECQKVCNCRLGLCHH
VTGDYGYTCYGGWTGSLCKVECPKGYHSSSCQGICDCKNGGFCDSENGKCRCRSGYHGDK
CQYQCPQGFYGRKCDGKCKCVQPDDVNGSSSTISSNNNNNNNNNCHFITGKCFCPAGKTG
PRCQNDCPSGTYGIDCVHKCACENEGVCDVATGACACSAGYTTATCGQRCPHGRFGANCM
NVCICQNNSTCHHVTGQCTCQHGYYGDLCQNVCEENTYGLNCESKCTCGRGKCDHVTGKC
TCPPGYSGDQCIEPCKPGTYGPGCGFQCTCPTNRCHTTTGLFLFGDSINNNINNNGNNGN
ILLFSNSKYQILIMK
Download sequence
Identical sequences T1EG70
jgi|Helro1|115175 XP_009027840.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]