SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1EHL1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T1EHL1
Domain Number 1 Region: 2-33
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000746
Family EGF-type module 0.018
Further Details:      
 
Domain Number 2 Region: 4-117
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000706
Family Growth factor receptor domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) T1EHL1
Sequence length 117
Comment (tr|T1EHL1|T1EHL1_HELRO) Uncharacterized protein {ECO:0000313|EMBL:ESN99892.1, ECO:0000313|EnsemblMetazoa:HelroP128131} KW=Complete proteome; Reference proteome OX=6412 OS=Helobdella robusta (Californian leech). GN=HELRODRAFT_128131 OC=Rhynchobdellida; Glossiphoniidae; Helobdella.
Sequence
FSRCIDNPCHDGATCLDSDQGYKCKCPDWMTGTGERGQGCTAIAKETCTPSPCYANVQCT
MNDTLGPVCGPCPNGLKGDGYVCNDIDECKDYQPCDPLTKCTNHHGGFTCSDCPSGF
Download sequence
Identical sequences T1EHL1
jgi|Helro1|128131 XP_009022009.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]