SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1EI74 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T1EI74
Domain Number 1 Region: 1-188
Classification Level Classification E-value
Superfamily vWA-like 3.34e-42
Family Integrin A (or I) domain 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) T1EI74
Sequence length 189
Comment (tr|T1EI74|T1EI74_HELRO) Uncharacterized protein {ECO:0000313|EMBL:ESO10219.1, ECO:0000313|EnsemblMetazoa:HelroP135215} KW=Complete proteome; Reference proteome OX=6412 OS=Helobdella robusta (Californian leech). GN=HELRODRAFT_135215 OC=Rhynchobdellida; Glossiphoniidae; Helobdella.
Sequence
DIVIILDESTSIVSGSNGNQNWESIKNFAVQIADSFPISTDLTKIGILKFSTSANVNQKI
DLNRYLTNSDLKSAILAFDLVGGETNIADALRNGRNMFSQSLGSRPDAPHIMILLTDGQA
NREAEKTIIEANMTKAANIIIYTIGVTSQIDENQLKNIATAPSDSHYFYVTEYSKLDSII
TDLVAQSCK
Download sequence
Identical sequences T1EI74
jgi|Helro1|135215 XP_009012033.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]