SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1EJZ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T1EJZ7
Domain Number 1 Region: 1-98
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.54e-31
Family Spermadhesin, CUB domain 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) T1EJZ7
Sequence length 98
Comment (tr|T1EJZ7|T1EJZ7_HELRO) Uncharacterized protein {ECO:0000313|EMBL:ESN91620.1, ECO:0000313|EnsemblMetazoa:HelroP147387} KW=Complete proteome; Reference proteome OX=6412 OS=Helobdella robusta (Californian leech). GN=HELRODRAFT_147387 OC=Rhynchobdellida; Glossiphoniidae; Helobdella.
Sequence
GVITSPNYPNNYPNKLDCKFSIEAPDGATITITFQEFSIEAESDCSFDRLEFIDPLSDNT
KLYCGSTLPPPVISKGNKVSFLFSTDSNVNNGNFKITY
Download sequence
Identical sequences T1EJZ7
XP_009030448.1.102002 jgi|Helro1|147387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]