SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1EKK3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T1EKK3
Domain Number 1 Region: 1-187
Classification Level Classification E-value
Superfamily Kelch motif 4.71e-35
Family Kelch motif 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) T1EKK3
Sequence length 187
Comment (tr|T1EKK3|T1EKK3_HELRO) Uncharacterized protein {ECO:0000313|EMBL:ESO08630.1, ECO:0000313|EnsemblMetazoa:HelroP151403} KW=Complete proteome; Reference proteome OX=6412 OS=Helobdella robusta (Californian leech). GN=HELRODRAFT_151403 OC=Rhynchobdellida; Glossiphoniidae; Helobdella.
Sequence
IFVAGGYERGNWCSSKAFYSYNPNIQQWVELSMMNEARVSFSLVSTNNGIYAIAGIDHIV
SNNIDREIILHSVEFYNPIDNVWSFSAPLTHGCYNMSAVSNNDHLYMSGGISDDPQHSVP
INNFYTKSIHSGDWRELAPLNVGRHSHVMIFKNENLFVLGGFMESEAAMGFNDCHQTEMY
DLETNQW
Download sequence
Identical sequences T1EKK3
jgi|Helro1|151403 XP_009013560.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]