SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1ERU6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T1ERU6
Domain Number 1 Region: 219-349
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.05e-23
Family Spermadhesin, CUB domain 0.00092
Further Details:      
 
Domain Number 2 Region: 367-491
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000183
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 3 Region: 24-85,149-202
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000605
Family Spermadhesin, CUB domain 0.0055
Further Details:      
 
Weak hits

Sequence:  T1ERU6
Domain Number - Region: 500-533
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000196
Family LDL receptor-like module 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) T1ERU6
Sequence length 616
Comment (tr|T1ERU6|T1ERU6_HELRO) Uncharacterized protein {ECO:0000313|EMBL:ESO02461.1, ECO:0000313|EnsemblMetazoa:HelroP161732} KW=Complete proteome; Reference proteome OX=6412 OS=Helobdella robusta (Californian leech). GN=HELRODRAFT_161732 OC=Rhynchobdellida; Glossiphoniidae; Helobdella.
Sequence
MQKALSHRTSSPLSSPQPSPSLPECDRIIRSNSQSSGIIKSPYYPEPSPRDILCHYDING
LVDRQNLEKVQLFIEDIDIGEDYVEEYVDTVVARGVAVGGAAASAAAGRNVARFNRSKCQ
NGALQAYTTRASQKSLAMYKIELQEQSTTKVSLPIPDYEFCGTSGNGRFGSYSITSDSPK
MLLIYDTFGARSRRGFKVRYQFSTDYAIPGTAISGESPCHFQYMSTSAIQGTFNSPRHPS
NYPDNTYCVYEFHGQPDEIVRLTFENFQVEDDANCSKDFVKIFKWLPPKLEEEGQQQQQV
ENLEFVPVGHYCGERFPGPQDEDSQIMRVTLNSDGHTVYKGFRARYEFVKRQPPDKKCFH
SITNIGGGVINSPNYPHKYTTNKTCEWIVYGRSKANKILLTFDIFSIEGNPNEKKSFKSN
QTKLSVEIGCGNAVLKIYSTSRSNMPAYELCGDNDTIDNLQIITKSNVLRLKFVSTAKAT
GGKGFRLPWTEILPMKGGRCPGFLCEKSGHCIPNDMKCNGVANCGKNDRSDELKNCETST
LNVVLCVLGVCFLLLILGGLLWLYCKRKKKKPEKDQKIPEVRIVTGVSEKRPRSANRKKR
RKKRRMKEKTEMITIM
Download sequence
Identical sequences T1ERU6
jgi|Helro1|161732 XP_009019869.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]