SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1ERU7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T1ERU7
Domain Number 1 Region: 177-284
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.07e-23
Family Spermadhesin, CUB domain 0.0017
Further Details:      
 
Domain Number 2 Region: 48-149
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-18
Family Spermadhesin, CUB domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) T1ERU7
Sequence length 298
Comment (tr|T1ERU7|T1ERU7_HELRO) Uncharacterized protein {ECO:0000313|EMBL:ESO02462.1, ECO:0000313|EnsemblMetazoa:HelroP161733} KW=Complete proteome; Reference proteome OX=6412 OS=Helobdella robusta (Californian leech). GN=HELRODRAFT_161733 OC=Rhynchobdellida; Glossiphoniidae; Helobdella.
Sequence
MNILIINSKCCLLVFILCRICHLKENCTTIKRSGPNHKTGILKSQANESYQNNIRCYYYF
EALPDERVELNFTVFDVNGVPPRCLHDFIDIYTQLDSLNVSLLDVPSQGRYCGKDKENLP
YLIISVKNIALVDFHTDSSGDGKGFELIYRFFSDAIYKVGTKLQQYLCGFLISDLKEGTI
LSPTYPGIYPDNIMCFYKFQGEVGERIKLTFNDIDLYSGGNYCPFDHIKIYDGPNNEAHV
IDTICGSRKVPIAFYSNGNYLQIFTVGESDETPSQLRGFNASFEIGTRFVDLSLVTLL
Download sequence
Identical sequences T1ERU7
XP_009019870.1.102002 jgi|Helro1|161733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]