SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1ES11 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T1ES11
Domain Number 1 Region: 139-181,244-315
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000249
Family Spermadhesin, CUB domain 0.0094
Further Details:      
 
Weak hits

Sequence:  T1ES11
Domain Number - Region: 322-366
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00116
Family Complement control module/SCR domain 0.0063
Further Details:      
 
Domain Number - Region: 179-233
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00575
Family beta-sandwich domain of Sec23/24 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) T1ES11
Sequence length 392
Comment (tr|T1ES11|T1ES11_HELRO) Uncharacterized protein {ECO:0000313|EMBL:ESO02619.1, ECO:0000313|EnsemblMetazoa:HelroP161907} KW=Complete proteome; Reference proteome OX=6412 OS=Helobdella robusta (Californian leech). GN=HELRODRAFT_161907 OC=Rhynchobdellida; Glossiphoniidae; Helobdella.
Sequence
MIAFTDIIKNYLVTVTIAIATTTIDLTETKEFCNMETFIANCSHIPNNLIVVEAASYGLM
RLGRCLKVDYSNKLGCRADVMAAMDRHCSGKVSCSVKLPDEQVYSLNVCPPEVTSYLDAS
YFCLNVEPENAQKCETATVLTSESGHISSLRSDLVRCRWFLKVPKGRRINITLIDFFHQP
NFQPYSHNYQIKHPQPQQPQQLQQPQQLLPTAISNINAQQQQQQQLHKHQPNHLSNYVTS
SECLKYAIVKETTTSDNSPPKISTICGGGPRVRTVYLSDTNSLEVSIYSALKGPFGTNGQ
IEKARFLLKYKAFGCPDLDPRGSDGWTVVREGEKSIISCNGSHDNASRYHLICEDDRWIG
DIPTCSARTADEAITNNDNNNNIYNINNKNTK
Download sequence
Identical sequences T1ES11
jgi|Helro1|161907 XP_009020027.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]