SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1ESS2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  T1ESS2
Domain Number - Region: 13-83
Classification Level Classification E-value
Superfamily Integrin domains 0.00204
Family Integrin domains 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) T1ESS2
Sequence length 101
Comment (tr|T1ESS2|T1ESS2_HELRO) Uncharacterized protein {ECO:0000313|EMBL:ESN99034.1, ECO:0000313|EnsemblMetazoa:HelroP162512} KW=Complete proteome; Reference proteome OX=6412 OS=Helobdella robusta (Californian leech). GN=HELRODRAFT_162512 OC=Rhynchobdellida; Glossiphoniidae; Helobdella.
Sequence
MLPNTVLTKATRRPRPLKLYPGHKISKRYMRARLNRRVLNSLKRVVPNIAGKKNVTECTQ
YNLMEFFNCTFITCQIKKLSSGAIQTDLRTGRFYERGFHVR
Download sequence
Identical sequences T1ESS2
jgi|Helro1|162512 XP_009022944.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]