SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1EX19 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  T1EX19
Domain Number - Region: 712-757
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000206
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) T1EX19
Sequence length 761
Comment (tr|T1EX19|T1EX19_HELRO) Uncharacterized protein {ECO:0000313|EMBL:ESN91541.1, ECO:0000313|EnsemblMetazoa:HelroP165594} KW=Complete proteome; Reference proteome OX=6412 OS=Helobdella robusta (Californian leech). GN=HELRODRAFT_165594 OC=Rhynchobdellida; Glossiphoniidae; Helobdella.
Sequence
MGNLLSRKNFIAGMYFMHTKRTRKGEKGRRYTSRLNAPFNRITFLPITIIVCRDNNVNNN
NNTDNTNNNTNNNKIDNNYGDITKSNNINVNNNNLKNKNDMSVEINVISNSDISKNINEG
ISNINHNIIDKINTSSNSNNNNKSIQSGNLILLATEHFLLQHVHPRSRLIDMAEVEQNGS
DVSVVFPTSTDKSASDDDGAEIYIVKAETFATEIYHVGSYRAVKKSGVNGSRDFNMTSAI
AQQVSALMQDKHFTNNNNNNNTNNDDDDAINMNNNNIKSINNNINNNDNDIINISNSNNK
NISNTKNNNDNDYVTNNNNNNLQTNIKDDINYINKTSQPDILSYKNINSNATSDLNAGDN
NGVKINVNNNNNNNLNDNNNRDYNNLVNNNNNNNNNKVAINIREYIRRIFHSGYNNNNNI
NNINNNNKHNNNIVSDNLNNNIIIDNNADKNITNKNNNNNIIIISNNIINNKNGNNNISS
NNNNININITNSNYNDINRASINNTNNNDQMTISKNKLVKQSYIEADPTFIIHPVKQTHI
NSNNYTTNNTNNSNYTLDNNNNNINNNTVDIIVNNHQDINTDFAINTFYTYNHTNNSIDN
NMINNNIYNNNTDNNNTNITNNNINNNYSEIAGSGMHENKVVNKVAILDSLKLPPTLSPA
SSSTSSSSPLSSSSSSSSQLSSPSSSLPPLQQIVEENQLQSGPCDVACPEEDCSDWSVCR
NGGKCNDVTGYDSGAIVRKHWCKCQSGFQGTDCAKKVVAGY
Download sequence
Identical sequences T1EX19
jgi|Helro1|165594 XP_009030380.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]