SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1EXQ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T1EXQ7
Domain Number 1 Region: 307-523
Classification Level Classification E-value
Superfamily Kelch motif 3.79e-48
Family Kelch motif 0.0000882
Further Details:      
 
Weak hits

Sequence:  T1EXQ7
Domain Number - Region: 276-307
Classification Level Classification E-value
Superfamily Nop10-like SnoRNP 0.00549
Family Nucleolar RNA-binding protein Nop10-like 0.0066
Further Details:      
 
Domain Number - Region: 26-122
Classification Level Classification E-value
Superfamily POZ domain 0.0126
Family BTB/POZ domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) T1EXQ7
Sequence length 601
Comment (tr|T1EXQ7|T1EXQ7_HELRO) Uncharacterized protein {ECO:0000313|EMBL:ESN90421.1, ECO:0000313|EnsemblMetazoa:HelroP166087} KW=Complete proteome; Reference proteome OX=6412 OS=Helobdella robusta (Californian leech). GN=HELRODRAFT_166087 OC=Rhynchobdellida; Glossiphoniidae; Helobdella.
Sequence
MKNDVDDVESNDGSTEEQIVLTSETGGRHPVVRSMLLRTSDYFQGLVNSGMRDAHYRELT
FQCLTNESLKEVRDYLSRLSTNEVEGRRPRLKSLNKVEAGLDGAFYLQINDMIDNYVEFL
LKHLNMSTCIRILNIANKYVLTDQVIEKVFRYMLKNFKDIPESFKISLSPDEMFRLVASE
EINADSEIDIFNLIIKWVSDDQTRKCFVEKLLTEVRYCLMTTAEKQECTAVLNDLKLNIC
HNKDKDSNISRTLGMLFAIGSTESKDQDGNFFNILRVYDFVEACKICDNSTAKPKPIRFN
PSGRRGPPRDLDGYNACVVGNCLYLVGGKPRKTSITCKVSRYNPVTAAWSKCCSMNLARR
QFYLGGLAGQLYAVAGVTANCSETPTVEKYTPSENRWYMVEPLPLALSHLAGCVWNGMIY
VSGGWDDCRDVRNVVYRYDPSCNKWFPRAPMLTERRSHVMTCTGNKIFVFGGKKVTQNAM
DGEMYDVENDQWSSVLKLKMPVCDSPSITINNCLYIFEHEFFSIYWFRKYIQKINLAKYL
KEKKTSNDSSLSSVQGGNANNNNLEQNSHSDDDCQILSYKRQKDRIPFECQYVGVMIMSD
I
Download sequence
Identical sequences T1EXQ7
jgi|Helro1|166087 XP_009031362.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]