SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1EZ74 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  T1EZ74
Domain Number - Region: 160-205
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0153
Family Merozoite surface protein 1 (MSP-1) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) T1EZ74
Sequence length 265
Comment (tr|T1EZ74|T1EZ74_HELRO) Uncharacterized protein {ECO:0000313|EMBL:ESO10772.1, ECO:0000313|EnsemblMetazoa:HelroP167270} KW=Complete proteome; Reference proteome OX=6412 OS=Helobdella robusta (Californian leech). GN=HELRODRAFT_167270 OC=Rhynchobdellida; Glossiphoniidae; Helobdella.
Sequence
MTNGLTITGNGSCTCGSKINYMVSYKSCRPNNNNKDGERNKSLTMFKRTYDVHAKTLAEA
TIVGCFKDFPTINRQHINNINTTNINNNNNNNNSGQNSKKNTLTMAEQFEACLNFCRLNN
FYYFSIKISECYCERDVDASKMVLISMCLADSRFYTVYTDCSKNNGDCGDNLKCERYQID
PLTPPLTQCLCENIWHPLYNGTHCFFMTSAVDYFASVVAIVSAIIAMLLLFSCMVACLSH
LCNRNRIKRTIEVADTLMEQEEEML
Download sequence
Identical sequences T1EZ74
jgi|Helro1|167270 XP_009011041.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]