SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1F010 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T1F010
Domain Number 1 Region: 18-91
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000534
Family Laminin G-like module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) T1F010
Sequence length 106
Comment (tr|T1F010|T1F010_HELRO) Uncharacterized protein {ECO:0000313|EMBL:ESO10120.1, ECO:0000313|EnsemblMetazoa:HelroP167978} KW=Complete proteome; Reference proteome OX=6412 OS=Helobdella robusta (Californian leech). GN=HELRODRAFT_167978 OC=Rhynchobdellida; Glossiphoniidae; Helobdella.
Sequence
METMYNNRDDVNGDGDDVKYTLDEQGGKLEIDRILDQESMGATGRDYHMGPCSSFNSLVF
GGLSHKIYNNHKIVKHRFSGCIRKLNIDGKHPIIPPKYFAVSTCEE
Download sequence
Identical sequences T1F010
XP_009011934.1.102002 jgi|Helro1|167978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]