SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1F0I7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T1F0I7
Domain Number 1 Region: 7-122
Classification Level Classification E-value
Superfamily POZ domain 1.14e-30
Family BTB/POZ domain 0.0044
Further Details:      
 
Domain Number 2 Region: 426-571
Classification Level Classification E-value
Superfamily Kelch motif 2.35e-30
Family Kelch motif 0.001
Further Details:      
 
Domain Number 3 Region: 294-411
Classification Level Classification E-value
Superfamily Kelch motif 1.44e-18
Family Kelch motif 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) T1F0I7
Sequence length 572
Comment (tr|T1F0I7|T1F0I7_HELRO) Uncharacterized protein {ECO:0000313|EMBL:ESO09403.1, ECO:0000313|EnsemblMetazoa:HelroP168385} KW=Complete proteome; Reference proteome OX=6412 OS=Helobdella robusta (Californian leech). GN=HELRODRAFT_168385 OC=Rhynchobdellida; Glossiphoniidae; Helobdella.
Sequence
MKKYVSAKYQHKVLRNLYKNFENGSFCDLTIVCKDASFKVHKLVLASSCDFFSSMFQFNF
NENKSNTIDLSHSKASIIRAVIKFVYTGSVKLTEDNVQDLLIVADQYGLSDLFKICTKFL
EKNIYASNVIGMHMLAEQLNCINLKNHSFKYMKNNFSDVVKSDEFLSMPLNLFINYISAP
DLSICTEIEVFEAGLAWICHDLKERESSAEEVMKTMRISVLPYPVVNDKLQFCSSIIVKN
YLGKVISEMLNGDYGKSICRSNRLMIECPINRLSASPRIYFMELIYSPIRCNRSSSMMYY
DVRRNEMKTIPLIKQQSDDTEQLIAAVDRRIYFFGGFGNLKTIEMLDTYENQHKTLGPWP
RRRSFGAACSVGNEIYLIGGLHETDNFHSDIDIFNTWTKKWRVLPFPREYTSTQHLGVVY
WKVFIEIKGLIYIIGGENGEQEAVSQCLIFNPITEKFDDMPNLLTPRSRFGISCYKDHIY
VAGGFDHDSNILCTIERYFIERGHWEKVNSLNVSRYMPTMVTVLDKLYILGGNTSLSYSS
SAIFEVYDPQKNKCSKIEPLLPLLMHPCAIAI
Download sequence
Identical sequences T1F0I7
XP_009012496.1.102002 jgi|Helro1|168385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]