SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1F1D9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T1F1D9
Domain Number 1 Region: 30-48,146-316
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.8e-28
Family Laminin G-like module 0.00068
Further Details:      
 
Domain Number 2 Region: 67-135
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000943
Family Ovomucoid domain III-like 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) T1F1D9
Sequence length 327
Comment (tr|T1F1D9|T1F1D9_HELRO) Uncharacterized protein {ECO:0000313|EMBL:ESO09150.1, ECO:0000313|EnsemblMetazoa:HelroP169094} KW=Complete proteome; Reference proteome OX=6412 OS=Helobdella robusta (Californian leech). GN=HELRODRAFT_169094 OC=Rhynchobdellida; Glossiphoniidae; Helobdella.
Sequence
MIPLKNMLKACNCSTFGSLRTDCEQSTGKCLCKPGYSGPQCQICPNGEHVASYGYHVKKN
GKRCVNDLNCKYGGKCKKVGQNIECVCPASCVESSVSSLSAVCASNGLTYSSECHLAQFS
CRSQVDITLQHYGPCVNNSDAGGSVGFDGTYYLKYVSKLMDDEERKLSSIQIEFSTDSPN
GVIFFEGESFSPASSFILIGIRRSKLVVMFNLGSNRADDLPLMTSSSDVSDQQWHLLTLR
RDERQMKMVLDFDEPIVAYSRPGANSFHSSGFFYLGGAEKRMKGLPRSLSAALKGCLRNV
QINKNVINLREDRINVDTELKKCHDAL
Download sequence
Identical sequences T1F1D9
jgi|Helro1|169094 XP_009013172.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]