SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1F2N2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  T1F2N2
Domain Number - Region: 257-308
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0732
Family Laminin G-like module 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) T1F2N2
Sequence length 362
Comment (tr|T1F2N2|T1F2N2_HELRO) Uncharacterized protein {ECO:0000313|EMBL:ESO07567.1, ECO:0000313|EnsemblMetazoa:HelroP170113} KW=Complete proteome; Reference proteome OX=6412 OS=Helobdella robusta (Californian leech). GN=HELRODRAFT_170113 OC=Rhynchobdellida; Glossiphoniidae; Helobdella.
Sequence
MCSRNIFYFIFNKYLIVACENFQILKKYSDEELGNSCYIKTLTLLFDGTKHSTLVYYLYS
SSQQHQQLQQRRHNYQHQHINQQPFHFPSYGTFQPHENLKPHFDHHHLLRKLNHGLSKNN
EDFDVQHFISDQTHSYNNFNNNHHNNNNNNNNNIHNFQNHKKNNVNKHEGSNISSATNKS
PNKINNIHESHHATNVLSNNRTINVAADPQFNYFTYNHNLLYSNKVSQVNNYLNNFYPPL
QNKNVNHYYNLKPPPLPRPRLYFSIFLRVRTTLSDCHIMHVYKSNVQHVYSLSLIQKKFQ
LEITKRSKLMLCNSYASHLYMDHCLAIGAEKAKYLIECGMKMLLTSLLFLQTVSNINVKK
IF
Download sequence
Identical sequences T1F2N2
XP_009014178.1.102002 jgi|Helro1|170113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]