SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1F3L1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T1F3L1
Domain Number 1 Region: 1533-1579,1653-1748
Classification Level Classification E-value
Superfamily Kelch motif 0.00000000000196
Family Kelch motif 0.0082
Further Details:      
 
Weak hits

Sequence:  T1F3L1
Domain Number - Region: 1237-1383
Classification Level Classification E-value
Superfamily Kelch motif 0.00235
Family Kelch motif 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) T1F3L1
Sequence length 1856
Comment (tr|T1F3L1|T1F3L1_HELRO) Uncharacterized protein {ECO:0000313|EMBL:ESO06879.1, ECO:0000313|EnsemblMetazoa:HelroP170910} KW=Complete proteome; Reference proteome OX=6412 OS=Helobdella robusta (Californian leech). GN=HELRODRAFT_170910 OC=Rhynchobdellida; Glossiphoniidae; Helobdella.
Sequence
MRELLREIQTLPNLCRLLLASTTSNRQRPVNAPPTRDNKLISFFHIVQILQLLQQQQQQQ
QQQKIQKQQPKQQQQHDQQHHQCHQNLSSLQIHLNEFIKNIEQHSNQEVIERGGTFLNNL
THLQQNNKRTVDDSLMQNIFQTFCNMQQTTDQQTAVVQQVEESLQQSESCEPSTNFSYIN
NNMFTITNNNTNNNNTNNNNNTNTINYNVVTDDKLHDVDNGMGNDDNSNKNLLNSFKTSF
IEKQNKLRKQYFDSSTNNNTSKLQQHQQHQQQLEDDVGGVYKFQRQTDRDNIQKSPEIHR
HEDPQIKTPPNDSSQHFQHVHNERNCFEYLGTIQIEQEETRKQNLQELRELQVQQQQQPQ
QPQQPQQRNSQLQLQSQPQRSGAQQTKLLDQFPKLEQLQLQQPQQVQQPQQSQQQPLLPL
QTHLQQFQQLQRQRQSYNFNEKIERDSEKSESNDEMIIIQVNSHQQTSARYHYSPQPLSI
STIYPSPPTIDEMLLNVHLNNVERHNQQNAGEDMVLSTFSSTKSFSGKFHGSSVAMSQSS
EEGPVTASTTSSTKTLATTTKTLITAVTSTSATVATTLTAAKATTSATAAMSKSDSPLHQ
PTLVSLNNNENVCRANIANFLQQTDFSTSSLSVSGCRMTSTIGSDVINDDDVKDHNDDNY
FDGNDNRSNDNNRECCYRYHADDQCCNILTHPDIQFDDDDDDDVKGYFFIPRHSYSYPTS
PHRHHHLPSPFLHHLPHNYNQYYHRYKGSCCVEDEKMENADDTKVTLNNNNSNNNCNNNN
CNNNCNNNNNCNNCCNNNCNNHNNIDNINNNNTNLSICINSTTTVANRTNKTINSPINND
SIVANNICNKFRRPLNIHVIKPSLALETFKLIPPCKNISQQNYTPAGYFFPKNGQQTEHI
FSKTTSPFPQLKNWQQRVESQKLKNSEFIEKISKTHCRCKIETSSGTLSGSREEEGNKIS
LPSLTSTPPKLHKHTAFKPYNNANNNNQQQFSRQFTFSSFSFSDPTSQWVLSSSHSSPTS
QKLLPSSSTTLTFTTQTSTTHAPTENQQNVKDLTNQAEINSITQQNEAKRFYSGYIPRLC
FNDVESGSWLLDIPLVEEPCGKHLRNVTASSNETFDNYSTSTEGSQRCLNNNSNDDNYFT
SRINVTSCDDNINDHHDSINFLSNQNNKYKNRSAESLTSLTNTSLLLINIPTTATKSKTS
STLTNSIQQTIYPNIKICDSATNHKEINNVANKIYALNIADSYTIKSNSWKELQLADNPN
FSNKIQHYCCATIFNKLYLFCCEASSNINNSKNGSVENVDNSNNDNRCNSYDDACSTSYK
VGYGNGKVLNKQSDAMGKHYTTNIYDFSQNRWTSGKPVSTRNEISTIGVYENNVILFHSG
GRFNQQQLHNLQTPDDGNYGDFEEDEICSRLKNSKADYKNLTGTFIPGKNVIKHKPDAIV
IDNQKSNGNPVTRKISYISVVSSLERSYSLSVTDNGSDASNDVTVCDVSEAGSDVTGNDR
SDASSEDFCKNSSAQKAANSYSSQSFPYESSELFTMLSYHADEDSWKEKSLPVKLPRAGV
AFSIWNDELFAVGGATLVHGDDEALSVNEGNLMHPTNLHILLHADVFKICLASFFCKRLK
QFEVSKHLENKYFKVSFGPGQVFSTCLDVPILTTSSSQHLLPAENSSVLKLSDLNVPTSH
STLAAVSGRLLLTGGLIQGGVTDRILMYQECNDLWVVLSATLTFPRYAMKGSVWKDKIFL
LGGFKSVKSVNKKTGSSCFLRKKATSFSEMLTVEVMSRNVEKNFDEERGTKKFGTDTVMN
IEEKVKHVAEKHIEKVVKCQVSVSQFEKPKEKSVDARSVVTAEKLGNNYFLRGKLL
Download sequence
Identical sequences T1F3L1
XP_009014975.1.102002 jgi|Helro1|170910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]