SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1F3M6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T1F3M6
Domain Number 1 Region: 9-82
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000937
Family Laminin G-like module 0.044
Further Details:      
 
Weak hits

Sequence:  T1F3M6
Domain Number - Region: 138-174
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0513
Family BAR domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) T1F3M6
Sequence length 241
Comment (tr|T1F3M6|T1F3M6_HELRO) Uncharacterized protein {ECO:0000313|EMBL:ESO06927.1, ECO:0000313|EnsemblMetazoa:HelroP170962} KW=Complete proteome; Reference proteome OX=6412 OS=Helobdella robusta (Californian leech). GN=HELRODRAFT_170962 OC=Rhynchobdellida; Glossiphoniidae; Helobdella.
Sequence
MDFGLFVLTFFDNTWHKIGVSFTPDRFEVFLDCAKVGSAYPHLTNFSHISLNGEIWMGRK
SVDIGIDFDLQWAMINCDPRIPMYENCIDLLPVPRATLTPATDQLLPTTTTSTTTSTTTT
TTTTSTKPLDFFHMPRYRLRNRYNFDLHEIVTERKLLEKQLLKLEIFLTRLEQLIPPKMY
ADVGFDGYDDVLEEEDSRDFGVGYYQRYHQHRNPHQMISDGEYHRATANRGETGRNKYSM
K
Download sequence
Identical sequences T1F3M6
XP_009015023.1.102002 jgi|Helro1|170962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]