SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1F3U0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  T1F3U0
Domain Number - Region: 10-91
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00426
Family Glycosyl hydrolases family 16 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) T1F3U0
Sequence length 2018
Comment (tr|T1F3U0|T1F3U0_HELRO) Uncharacterized protein {ECO:0000313|EMBL:ESO05485.1, ECO:0000313|EnsemblMetazoa:HelroP171116} KW=Complete proteome; Reference proteome OX=6412 OS=Helobdella robusta (Californian leech). GN=HELRODRAFT_171116 OC=Rhynchobdellida; Glossiphoniidae; Helobdella.
Sequence
MWKDKSLLHSFHTAFVIFSNNNVSFYVNCTLVDEVSVKTRSFRITNPLHIDGSYQFGGFF
GRDKTIGELEEFFVNSEADERKLKNYCLRRCDDIQYQFYSTTMKWLKEKTQTTTSPKDYN
YYYYYYTNGDENDDSLNYIDMKKSLTTIKIPNISEIKESEINNSTLTKSTIIETILKKEE
NVHDSEQNEKHIQAMNISKKTTNDITNITTKSEIERQKTTEPTKQMTNIEGLIPPTTSET
FVSKTEEKKTIPTVTKDIKEADAEKKTRPSLTINETVIDKVPTVESEETHETKIIEETKT
IITTSVETKKKDDEITAEKKQKPFEKYKVTLIETEEIDKKKIDPMTPAEDKKTSADKEDK
EKVVTITTKKKDEENIKKPKPEETVVTTETNKQTTVGTEITGETTIIKETKTIITTDIET
KKQTEELIAKKDEKKTLEEDIVTIIKEKPIDSTTPPKEDETSVDREDKEIFVKITTEKEE
DVEKLKPKEIIVSTKTVEQPAVESEITGETTIIKETKTIITTVVETKKQTDELTATEEEE
KKPLEEDQVTIIETEEEIDEKPIDSTTPPKEDETSVDKEDKEIFVKITTEKEEEKDVEEL
KPKKIIVTTETVEQPAVESEITGETTIIKETKTIITTVVETKKQTDELTTTEEEEKKPLE
EDQVTIIETEEEIDEKPIDSSTPPKEDETSVDKEDKEIFVKITTEKEAEEDVEELKPKKI
IVTTETVEQPAVESEITGETTIIKETKTIITTVVETKKQTATEEEEKKPLEEDQVTIIEA
EEEIDEKPIDSTTLPKEDETSVDKEDKEIFVKITTEKEEEEDVEELKPKKIIVTTETVEQ
PAVESEITGETTIIKETKTIITTVVETKKQTDELTATEEEEKKPLEEDQEEKKPLEEEHV
TIIETEEEFDEKPTDSTTPPKEDETSVDKEDKEIFVKITTEKEEKEDVEELKPKKIIVTT
ETVEQPAVESEITGETTIIKETKTIITTVVETKKQTDELTATEEEEKKPLEEDQVTIIET
EEEIDEKPIDSTTPPKEDETSVDKEDKEIFVKITTEKEEEEDVEELKPKKIIVTTETVEQ
PAVESEITGETTIIKETKTIITTVVETKKQTDELTATKKEEKKPLEDDQVTIIETEEEID
EKPIDSTTPPKEDETSVDKEDKEIFVKITTEKEAEEDVEELKPKKIIVTTETVEQPAVEL
EITGETTFIKETKTIITTDVETKKQTNELTATEEEEKKPLEEDQVTIIETEEEIDEKPSD
STTPPKEDETSVDKEDKEIFVKITTEKEEEEDTVEQPAVESEITGETTIIKETKTIITTV
VETKKQTATEEEEKKPLEEEHVTIIETEEEIDEKPTDSTTPPKEDETSVDKEDKEIFVKI
TTEKEEEEDVEELKPKKIIVTTETVEQPAVESEVTGETTIIKETKTIITTVVETKKQTNE
LTATEEEEKKPLEEDQVTIIETEEKIDEKPIDSTTPPKEDETGVDKEDKDISVKITTEKE
EEEDEEKKPLEEEHVTIIETEEEIDEKPIDSTTPPKEDETSVDKEDKEIFVKITTEIEEE
DVEELKPKKIIVTTETVEQPAVESEITGETTIIKETKTIITTVVETKKQTDELTATEDEE
KKPLEEEHVTIIETEEEIDEKPIDSTTPPKEDETSVDKEDKEIFVKITTEKEEEEDVEEL
KPKKIIVTTEAVEQPAVESEITGETTIIKETKTIITTVVETKKQTATEEEEKKPLEEEHV
TIIETEEEIDEKPTDSTTPPKEDETSVDKEDKEIFVKITTEKEEEDVEKLKPKKIIVTTE
TVEQPAVESEITGETTIIKETKTIITTVVETKKQTDELTATEEEEKKPLEEDQVTIIETE
EEIDEKPIDSTTPPKEDETSVDKEDKEIFVKITTEKEEEDVEELKPKKIIVTTETVEQPA
VESEVTGETTIIKETKTIITTVVETKKQTDELTATEEEEKKSLEDDQVTIIETEEEIDEK
PIDSTTPPKEDETSVDKEDKEIFVKITTEKKKKKTSKN
Download sequence
Identical sequences T1F3U0
jgi|Helro1|171116 XP_009016118.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]