SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1F5L8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T1F5L8
Domain Number 1 Region: 3-77
Classification Level Classification E-value
Superfamily Kelch motif 0.00000000000471
Family Kelch motif 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) T1F5L8
Sequence length 161
Comment (tr|T1F5L8|T1F5L8_HELRO) Uncharacterized protein {ECO:0000313|EMBL:ESO04249.1, ECO:0000313|EnsemblMetazoa:HelroP172605} KW=Complete proteome; Reference proteome OX=6412 OS=Helobdella robusta (Californian leech). GN=HELRODRAFT_172605 OC=Rhynchobdellida; Glossiphoniidae; Helobdella.
Sequence
MAQLLNKRLNHIMISTNNKLIVIGGVIHDAESSTWPDVMSGEVYDCEANQWTYLLTLMKP
VFNFAFFTMNNCLYIMGENKSSHNCSINPFIQKINLSTYLEINNTSGNTVGNINNDVNKI
NHNKVNHNNKGDGCQILNYNAERSLIYHVFGTMISSKQFLK
Download sequence
Identical sequences T1F5L8
XP_009017518.1.102002 jgi|Helro1|172605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]