SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1FAQ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T1FAQ7
Domain Number 1 Region: 798-947
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.56e-20
Family Laminin G-like module 0.00097
Further Details:      
 
Domain Number 2 Region: 556-746
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000317
Family Laminin G-like module 0.027
Further Details:      
 
Domain Number 3 Region: 329-479
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000231
Family Laminin G-like module 0.0038
Further Details:      
 
Domain Number 4 Region: 197-235
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000485
Family Ovomucoid domain III-like 0.0068
Further Details:      
 
Weak hits

Sequence:  T1FAQ7
Domain Number - Region: 174-204
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00262
Family beta-sandwich domain of Sec23/24 0.044
Further Details:      
 
Domain Number - Region: 512-534
Classification Level Classification E-value
Superfamily EGF/Laminin 0.021
Family EGF-type module 0.035
Further Details:      
 
Domain Number - Region: 14-40
Classification Level Classification E-value
Superfamily EGF/Laminin 0.031
Family Laminin-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) T1FAQ7
Sequence length 981
Comment (tr|T1FAQ7|T1FAQ7_HELRO) Uncharacterized protein {ECO:0000313|EMBL:ESN99851.1, ECO:0000313|EnsemblMetazoa:HelroP176619} KW=Complete proteome; Reference proteome OX=6412 OS=Helobdella robusta (Californian leech). GN=HELRODRAFT_176619 OC=Rhynchobdellida; Glossiphoniidae; Helobdella.
Sequence
MGKILQGNEGCLPCLCDVFGSVRSDCDHVTGQCLCRSNNVNNNNNNNINNIKNNINNTIN
NNNIVNNNNNNINNNFINNINNKNNNNVNNINNNNININIENNNNINNNNININNNINNN
NINNINNNIINININISNNNNNSNNSNRSNNDDRNFDQRLNYICLCPAFNCDLQQRQQHQ
QQHQQQHQQKHQQQHQQQQQFVCGTNNLTYKSHCHLKMHSCRHQLDVGLSYYGRCLDSLA
KPMLTDDNSNIAYGLELKMSHFERIQIIIRPRNNFGVIWSLVKSRKDENDDDRGDDDYHP
FSDGGDDDNDYGDGGVGVDGGGGKSGAFNHGDYAVLYLWDGFVCYKYDLGSGPTTLQSAN
QITPNQRYRITIERNRKEAWMLMESLNNNNNNKNNNNNKITGKSAGEMVAMDDTDVIVVG
FNRRSLKNRLDVKTSFRGCVEMLSVDNGSEKRFYDTSVKYRPSYRIEPCPTYPCDSVTCL
NGGTCLETSSLRHNNNNNNNNNNQYFQYHYHHLYRHQYYCLCKDGYIGQNCGQHLKHAKC
PDDHCNGRGSCYDKLCSCQLGYIGDKCQASSSSSSSSSPMSYDFSSSDYVQWSLTDNIAK
SFSFQLWFMTRKLNGLLLYGSQDVTLVYSSGACSSKNNNNNNNNNKNNNINNNNNNGINP
SQVPVTKYTWHRVIIQRHLKTSTLTLDFWPEVKVVGSGAYEELNVPMFIFIGGLPSTGKN
EKKLGGGCGSWGGEFRGFDGVIKRFYEKTHHHFNILTRAQGHTPLRVYPKGENFCKGDGD
DDPCKNNGRCVELLHGYYCLCVGDFYGANCDQYGLILLQKSSKNFPDGDFLALALVDGRV
VLAADLGREGVDNMMVVRSDVLVYGDHKWHHVFVHRNRRLMTLIVDHSDHPQHSLTNPGA
NNLDTDGYIYLGGGGQLLHSRPPEGLPAEFYLSYVGCLKNFEVEGGRILQNYSENQLQYF
YAGSLLAIEQFRNFNSLQAGF
Download sequence
Identical sequences T1FAQ7
jgi|Helro1|176619 XP_009022195.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]