SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1FC65 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  T1FC65
Domain Number - Region: 64-100
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000754
Family EGF-type module 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) T1FC65
Sequence length 110
Comment (tr|T1FC65|T1FC65_HELRO) Uncharacterized protein {ECO:0000313|EMBL:ESN97691.1, ECO:0000313|EnsemblMetazoa:HelroP177746} KW=Complete proteome; Reference proteome OX=6412 OS=Helobdella robusta (Californian leech). GN=HELRODRAFT_177746 OC=Rhynchobdellida; Glossiphoniidae; Helobdella.
Sequence
MDHCTQLDSTNAIEVFSVLFERSFDEGTEEYHFCLNDVVESNESYCEQGVCVPGWQGTFC
DIRDCKIKNGGCGRNFKCFQIIVNNSPFMNCACERGYSSADNEECISTFS
Download sequence
Identical sequences T1FC65
XP_009024151.1.102002 jgi|Helro1|177746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]