SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1FLF8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T1FLF8
Domain Number 1 Region: 1-81
Classification Level Classification E-value
Superfamily PHM/PNGase F 0.000000000000068
Family Peptidylglycine alpha-hydroxylating monooxygenase, PHM 0.00086
Further Details:      
 
Domain Number 2 Region: 76-145
Classification Level Classification E-value
Superfamily PHM/PNGase F 0.0000000262
Family Peptidylglycine alpha-hydroxylating monooxygenase, PHM 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) T1FLF8
Sequence length 147
Comment (tr|T1FLF8|T1FLF8_HELRO) Uncharacterized protein {ECO:0000313|EMBL:ESN89990.1, ECO:0000313|EnsemblMetazoa:HelroP184544} KW=Complete proteome; Reference proteome OX=6412 OS=Helobdella robusta (Californian leech). GN=HELRODRAFT_184544 OC=Rhynchobdellida; Glossiphoniidae; Helobdella.
Sequence
MPVVHHILLYGCEVPGSDDDAWECGDMTSLQASSSPPSDQYKHAPVCGEGSKQSILYAWA
MDAPKLQLPPNVGIQQPKKAGVYLLTSVDGEVGVRGTTHMEVACVMQEDRVIHPFAFRRV
LSGYRIRDGVWTEIGRKDPRLPEVVIP
Download sequence
Identical sequences T1FLF8
XP_009031911.1.102002 jgi|Helro1|184544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]