SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1FM75 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T1FM75
Domain Number 1 Region: 54-266
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.96e-65
Family Calnexin/calreticulin 0.000000238
Further Details:      
 
Domain Number 2 Region: 265-405
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 7.19e-59
Family P-domain of calnexin/calreticulin 0.000000348
Further Details:      
 
Weak hits

Sequence:  T1FM75
Domain Number - Region: 407-451
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000206
Family Calnexin/calreticulin 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) T1FM75
Sequence length 574
Comment (tr|T1FM75|T1FM75_HELRO) Uncharacterized protein {ECO:0000313|EMBL:ESO01982.1, ECO:0000313|EnsemblMetazoa:HelroP184962} KW=Complete proteome; Reference proteome OX=6412 OS=Helobdella robusta (Californian leech). GN=HELRODRAFT_184962 OC=Rhynchobdellida; Glossiphoniidae; Helobdella.
Sequence
MKKLPVLFLCLAFLYIYVNCEDSGEFEDEEEDVSEVESKQQEPDSPPREKPVYSPPVLST
PVYFADHFESPELFEKKWILSRSKKDDAESTISKYDGLWAVEEPKTSALKGDLALILKSK
AKHHAVSSALKRPFEFNDDPLVVQYEVKFEEGQECGGAYIKLLSKCNDNVDLSKFNDKSP
YTIMFGPDKCGNDHKLHFIFRHKNPLTGVYEEKHAKKPSANIDTYFSDKKTHLYTLVVKP
DNSYAIYVDQYEVSRGSLLEDFTPPVNPSKEIVDPDDKKPDDWDDRERIRDPDAVKPEDW
DETEPEMIDDVDATKPAGWLDDEPELIPDPAAEKPSDWDEDMDGEWEAPLINNPRCASAP
GCGAWKVPQIKNPKYKGKWEVPMIDNPNYKGKWSPRTIPNPDYFEDNQPFRMSPIGAIGL
ELWSMSNDIVFDNFIITTSKQTADEYAKQTWSIKHSEEASDSAGGFMQSVVDATHERPWL
WAVIVVVVVLPIVLIVAYCCLSSKGEDRKAGERKKMDARTADDEVDDDENEEYGEEAEGP
KEGGDSEYVGNYDSAEKKVTKRTKSDLESKPDQD
Download sequence
Identical sequences T1FM75
XP_009019390.1.102002 jgi|Helro1|184962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]