SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1FMB0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T1FMB0
Domain Number 1 Region: 208-376
Classification Level Classification E-value
Superfamily Kelch motif 2.88e-30
Family Kelch motif 0.024
Further Details:      
 
Domain Number 2 Region: 33-163
Classification Level Classification E-value
Superfamily Kelch motif 1.06e-28
Family Kelch motif 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) T1FMB0
Sequence length 420
Comment (tr|T1FMB0|T1FMB0_HELRO) Uncharacterized protein {ECO:0000313|EMBL:ESN98682.1, ECO:0000313|EnsemblMetazoa:HelroP185029} KW=Complete proteome; Reference proteome OX=6412 OS=Helobdella robusta (Californian leech). GN=HELRODRAFT_185029 OC=Rhynchobdellida; Glossiphoniidae; Helobdella.
Sequence
MGNEASSSQDGSQRIPNDINLSWERLVFEDIEARDGHCACACDGKLYIFGGVKHGGGAGG
KDGFHESNELLVFDPIARTCKVLNGGGDIPVSRSSAVLACVKDNLYLFGGLNADSGWFND
LHLYNTTTNLWKRIDLPSGPTPRDKMATTVVGSNIYIFGGFGPYCKAQVENAINKENVEE
EEDEEEEEEEEEPLDDSNILDDESAKFGWFDDLYIFNTEINMWIQPVQMNLACPSPRAAH
SMSATSRGVIIFGGRDKHGRNNDLHIYDTNSRKWVTDLSIAGKYPSARSFHSSVAVGDRV
LVCGGRAADEHHFNDAHIFDSETLQWLQPIVNLDTNYTKRGVHTMNVVGDYIVMFGGSAD
FDAETVQCTTFLNDFYLLKKSDVLKGAALPEISSENDGMNVDEDGGGADENAKIETRQRK
Download sequence
Identical sequences T1FMB0
jgi|Helro1|185029 XP_009022674.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]