SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1FND7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T1FND7
Domain Number 1 Region: 133-333
Classification Level Classification E-value
Superfamily Kelch motif 5.49e-49
Family Kelch motif 0.00062
Further Details:      
 
Domain Number 2 Region: 6-188
Classification Level Classification E-value
Superfamily Kelch motif 2.35e-44
Family Kelch motif 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) T1FND7
Sequence length 335
Comment (tr|T1FND7|T1FND7_HELRO) Uncharacterized protein {ECO:0000313|EMBL:ESN98091.1, ECO:0000313|EnsemblMetazoa:HelroP185872} KW=Complete proteome; Reference proteome OX=6412 OS=Helobdella robusta (Californian leech). GN=HELRODRAFT_185872 OC=Rhynchobdellida; Glossiphoniidae; Helobdella.
Sequence
MPFKSLNSMPTKRVYLKAVECNGFIYGIGGSDAKGQPINSMESFNQSNSKWKGHGCMSVN
RAAPGCMVVGESIVVMGGISDGQEVTDSVEVFDTKTKEWSGRDGMKEALSGIACVVHDDR
IFVVGGSAKDTNPRDYLMQYDLQNKTWKSLKDMPTARYAATAFILRDNLYVIGGRQGKLA
TNAFEVFDMNVGTWRKLPNLPSKNVFNQIVHTDTHVYALGGLDKDQKIKDTLEIFDLKTE
KWTQGPSMKNKRADFVAAMLNEKLWVAGGVSEVDKIKKPTDSVEIFDPTNNTWTDHPSVP
SPFCSASYCTSKDNKLYVAGGMTLDGVTNNFFVLS
Download sequence
Identical sequences T1FND7
XP_009023784.1.102002 jgi|Helro1|185872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]