SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1FNI6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T1FNI6
Domain Number 1 Region: 128-395
Classification Level Classification E-value
Superfamily vWA-like 4.23e-87
Family Trunk domain of Sec23/24 0.00000121
Further Details:      
 
Domain Number 2 Region: 8-66,413-522
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 5.36e-68
Family beta-sandwich domain of Sec23/24 0.00011
Further Details:      
 
Domain Number 3 Region: 626-766
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 6.28e-56
Family C-terminal, gelsolin-like domain of Sec23/24 0.00000481
Further Details:      
 
Domain Number 4 Region: 523-625
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 4.45e-46
Family Helical domain of Sec23/24 0.00000924
Further Details:      
 
Domain Number 5 Region: 49-122
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 9.16e-22
Family Zn-finger domain of Sec23/24 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) T1FNI6
Sequence length 770
Comment (tr|T1FNI6|T1FNI6_HELRO) Uncharacterized protein {ECO:0000313|EMBL:ESN95356.1, ECO:0000313|EnsemblMetazoa:HelroP185982} KW=Complete proteome; Reference proteome OX=6412 OS=Helobdella robusta (Californian leech). GN=HELRODRAFT_185982 OC=Rhynchobdellida; Glossiphoniidae; Helobdella.
Sequence
MSTYQEFIQQNEDRDGIRFSWNVWPSSRLEATRLVVPLGCLYTPLKERPDLPPIQYDPVL
CTRAICRAVLNPFCQVDYRAKVWTCNFCFQRNSFPPQYSAISEQHQPAELVPHFSTLEYT
LTRVQCHPPIFLIVLDTCMEDEDLQAVKESLQMSLSLLPPNALVGLITFGKMVQIHELGC
EGYSKSYVFKGTKDFTAKQVQELLGIGKGHMGPHAHRPSNPQQGQQQLPYSRFLQPLHKC
DMALTDLLGELQRDPWPVAQGKRPLRSTGVAASIAVGLLECTYPNTGARIMIFMGGACTQ
GPGQVLGDELKYPIRSHHDIEKDNCKYMKKAMKHYESLAHRACNNGHVVDIYACALDQTG
LLEMKYLPTLTGGHMVMGDSFNTSLFKQTFQRVFAKDSKNEFKMAFAANIEVKTSKELKV
QGCIGSCTSMSNKTGTNISETEVGVGGTCQWRMCGLYPNTTYAFFFEVANQHNAPIPQGG
RGYIQFITQYQHSSGQRRIRVTTLARNWFDAAVNIQNIAAGFDQDAAAVLMARIAAFRAE
TDEGPDVLRWLDRMLIRLCQKFGEFNKDDPNSFVLSQQFTLYPQFMFHLRRSQFLQVFNN
SPDETTYYRHMLMVEDIQQNLIMIQPIIYAYSFNGPPEPVLLDTSSILPDRILLMDTFFQ
ILIYHGETIAQWRKAGYQDLPEYQNFKQLLQAPVDDAQDILQTRFPMPRYIDTESGGSQA
RFLLSRVNPSQTHNNMYSYGQEGGGHVLTDDVSLQVFMEHLKKLAVSSNS
Download sequence
Identical sequences T1FNI6
XP_009026518.1.102002 jgi|Helro1|185982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]