SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1FNN0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T1FNN0
Domain Number 1 Region: 281-566
Classification Level Classification E-value
Superfamily Kelch motif 2.75e-46
Family Kelch motif 0.0006
Further Details:      
 
Domain Number 2 Region: 16-130
Classification Level Classification E-value
Superfamily POZ domain 5.65e-29
Family BTB/POZ domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) T1FNN0
Sequence length 591
Comment (tr|T1FNN0|T1FNN0_HELRO) Uncharacterized protein {ECO:0000313|EMBL:ESN93666.1, ECO:0000313|EnsemblMetazoa:HelroP186086} KW=Complete proteome; Reference proteome OX=6412 OS=Helobdella robusta (Californian leech). GN=HELRODRAFT_186086 OC=Rhynchobdellida; Glossiphoniidae; Helobdella.
Sequence
MAERLDLVASKKWVYSTYGNVLVKSVRSLQANDELCDFTITADKKSIRVHKVILAATSEY
FRAMLRGYMKETKEDIVDLGGISASSLEMIVEFIYSGEMELNPDCLIDMLNAANHLQIPT
ALELCSDYIISLITFANAEEFVHIADIYSLEKVIDFFTDKVLTNFETFTEAPVFLSTSVS
PLMCYLQSDRLKIKSEVLLFDAILKWFRHDSARIESIPTLLRCIRYGLIPKTTLQSSHPI
FALFPDEAQLLQTGLKYHADYLKGHPEPDINWRIRTNETSLIIVIHGSSNRPLEIVAYEK
STSNFYLVGSDTNASRDCRVVEVENYLYIFRVVDSGGGAFVNCLIRFDPRHLTLIILLPG
RTIRLDPAIVVHGKKIFCIGGCMDVPQGIHGNTMLDTVEVYNLADNTWSFVSPIPDATHS
HAACAARNLIYYSGGIAASNRGAASPNFVQFNPQTEEYNYLCPMHSPRRLHEMEALNDHI
YVLGGIGSHSYDHKKNLIPIERYSIDTDQWTILSGTLAGRSIGHYVVVNDTIISLGREHI
SATEDAIWSYSPETDSWTPYTKIPHKTSLALSAGSFLNINFADEKVSKRKV
Download sequence
Identical sequences T1FNN0
jgi|Helro1|186086 XP_009028299.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]