SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1FPN4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T1FPN4
Domain Number 1 Region: 45-228
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.17e-16
Family Laminin G-like module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) T1FPN4
Sequence length 259
Comment (tr|T1FPN4|T1FPN4_HELRO) Uncharacterized protein {ECO:0000313|EMBL:ESO13114.1, ECO:0000313|EnsemblMetazoa:HelroP188112} KW=Complete proteome; Reference proteome OX=6412 OS=Helobdella robusta (Californian leech). GN=HELRODRAFT_188112 OC=Rhynchobdellida; Glossiphoniidae; Helobdella.
Sequence
MMMKKFRVFVCLVLLLVSASLSRIKGPKRQRSVTPCFLFRSNDTIALTQGLSSYVEIGEI
NVGDDFSLYMEVLPSPMNHNGILLSVGSKTNFGYYSWKTEAVTVQFLVVEFIFSALALTV
KALNTEHLQQIEIYKTSPVPYKIDDARWHTIKVNQNRSHWIVQLDNLRVERLITNTTNVV
LYQQPAFIGGRPQYIDHQFQGIIKNVKINGRAIQGKDTTKVYVNKLNCSSLEVSHFTTWI
KTLKSQNQYDKKLPTSHAI
Download sequence
Identical sequences T1FPN4
jgi|Helro1|188112 XP_009009834.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]