SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1FQL7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  T1FQL7
Domain Number - Region: 143-172
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00795
Family Merozoite surface protein 1 (MSP-1) 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) T1FQL7
Sequence length 212
Comment (tr|T1FQL7|T1FQL7_HELRO) Uncharacterized protein {ECO:0000313|EMBL:ESN99394.1, ECO:0000313|EnsemblMetazoa:HelroP189059} KW=Complete proteome; Reference proteome OX=6412 OS=Helobdella robusta (Californian leech). GN=HELRODRAFT_189059 OC=Rhynchobdellida; Glossiphoniidae; Helobdella.
Sequence
MGLQVKGKRKIICMFTKIDCFLKTDFHMGSEEDLCRVNSSQAATRLRDDKNLYEPTKGGN
ANSAYLALPYIIIPIFKIQYFNKLDLNRKLLNVLDLESMRVEKVLIVLVANLRSMNMNLA
AVAHLLRPPTSVRSERLFSVVSDVNNDHCSKYIACYQIRPKTIKCICTNPAPDWCLQIRL
NSAAAGLGKVKSAIALANECLSSNDAVAIAHI
Download sequence
Identical sequences T1FQL7
jgi|Helro1|189059 XP_009023238.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]