SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1FQR7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T1FQR7
Domain Number 1 Region: 833-950
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000534
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 2 Region: 536-684
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000518
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 3 Region: 23-178
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000000624
Family Fucose binding lectin 0.019
Further Details:      
 
Domain Number 4 Region: 705-763
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000193
Family EGF-type module 0.01
Further Details:      
 
Domain Number 5 Region: 180-314
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000024
Family Fucose binding lectin 0.016
Further Details:      
 
Domain Number 6 Region: 780-835
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000699
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) T1FQR7
Sequence length 994
Comment (tr|T1FQR7|T1FQR7_HELRO) Uncharacterized protein {ECO:0000313|EMBL:ESN96316.1, ECO:0000313|EnsemblMetazoa:HelroP189192} KW=Complete proteome; Reference proteome OX=6412 OS=Helobdella robusta (Californian leech). GN=HELRODRAFT_189192 OC=Rhynchobdellida; Glossiphoniidae; Helobdella.
Sequence
MALKILMVLALSSCCIIDINASVVNVSIRKPAYMTNEATGHSAKLGVDNDITTSTETLSS
QTTPKWFVVDLVNAYQVKYIILYNEHSCGSCDSDMNYFNVGLTNSFNPSGTAEIRGTYDQ
CGWWPAPVTAADTQMSVICEDGTKFSRFIIIQQSLEVENNGASSSLQLGELMVYANDVFP
QYENVAYKKKAYLSTEQVSASNCVDGNTTSFCSLGSEVYGPYMNMSHEYDWFIVDLARPY
QIVYVTLHAKATDTLMNNFVVGQLSSVNPTYPTYLRGRYSVCGYGPPSYTIDAQPMRVDC
NDRTSYFRYVIVQQEASQAYDGENNADKYVGCFRNFQIKLTYQESSLDTCIYICRQMNVP
YASVKDSQCFCAPLNVGYLGCFIDGSLDLSADYESIPSRTIETCITYCLSRNYDYAGLQR
GDTCKCGNSYGAYGKDSDSACNTNCAGNTNEECGDSLKHYLVCSKLSTSKHCTGVYHCST
GNNFTPDMTCQSHSCQPGWTGGACDKRDCQTNNGGCGIHPCSSFQIGTTTYTECVCRLGY
TKSFYNDDCVLGEFFQMYVQFVLTCNTTNSICVAGSTDYSCNCKSGYQHPADNNTFCYDI
DKCAASTNPCRTPSETCVNTDGSKKCPCSPGYMLSAASVCEDIDECFENKNNCTKPLSTC
LNTYGSFICICPSGYVQVNNDCSDNVLYFTSSKIFFKRLSKNKFFLDIDECLYNPNACDN
ETTTCVNRVGTYSCKCLSGFYAKNPWTCEDIDECARNKHNCTNSTETCVNTFGSFVCQYI
NECKVETSSACNIATSTCFNMIDTYNCTCLDGFFNKDQWTCEDIDECALNQHNCSSPTET
CINTAGSFACQCSSGFQRFNNICSDINECLDKTSPCDPQTSTCVNQIGSYNCSCFSGFQN
KGQWICEDINECVKNANACNTAISTCVNNVGTFSCACFSGYVNKDQWNCEVSGERNVLFA
FIGVFAAVVLTLMGVFAYWAASYQFKPARANFSE
Download sequence
Identical sequences T1FQR7
jgi|Helro1|189192 XP_009025498.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]