SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1FR11 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T1FR11
Domain Number 1 Region: 48-143,193-443
Classification Level Classification E-value
Superfamily MFS general substrate transporter 1.44e-35
Family LacY-like proton/sugar symporter 0.027
Further Details:      
 
Domain Number 2 Region: 468-521
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000574
Family Ovomucoid domain III-like 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) T1FR11
Sequence length 640
Comment (tr|T1FR11|T1FR11_HELRO) Solute carrier organic anion transporter family member {ECO:0000256|RuleBase:RU362056} KW=Complete proteome; Reference proteome OX=6412 OS=Helobdella robusta (Californian leech). GN=HELRODRAFT_189402 OC=Rhynchobdellida; Glossiphoniidae; Helobdella.
Sequence
MVSKNNVESASANQNGINSENARNINSQSLEYRCCNTRPAILQCINNIKWVVFFFCLAHC
LQNATNGLLGVTISTLQKRFGFSSLECSILASAYEMGQVPAVICIILFGQRLHRPLAIGC
GMLLVALGCFLQFLPQFFTTPYLPMQQIESEPHFLSSNLSETGRGGLCSSEEQPSDEDCQ
RDTNEYKGFLFMFLIGRFLVGVGSTPIVTVGLTYINDCTTKEQFALFSGIFNSMSIVGPA
AGVLCASLMLGQFVDFYRVDSDVASLGITSDDARWIGNWWMSYLFLMFFCLFCAIPTLGY
ANDLPGAQEIRKSRVSEAHTTSKPSKSATDPYSKGKVDEEEKSLRIVLSLLCNPTFLLVC
VFNFCDMFFVVGFNAFGPKIFENFFHMQPSFAGLLFGAVLLPSGAIGTILGGFLISHFKM
TSRMMIRVQLVLSAVVVVTLPIVLVNCSNISFAGVTRPLMSSDDNIQMTGECNRDCHCEG
INFQPVCSQSQVQYFSPCHAGCSSKIHNPETNIYEYHKCACISESVGNYLNTSSSYNLTN
KQEGTSDNISALVDIEAFGKSCDLHICSKAFIFMPIFAVTVCIVFICFTMNTAIMFRLVT
AMAANAVHNKLIMLLLVNYFTVQFVNLMGKKFANCKEHRR
Download sequence
Identical sequences T1FR11
XP_009027532.1.102002 jgi|Helro1|189402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]