SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1FR57 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T1FR57
Domain Number 1 Region: 304-524
Classification Level Classification E-value
Superfamily Kelch motif 7.98e-46
Family Kelch motif 0.00023
Further Details:      
 
Weak hits

Sequence:  T1FR57
Domain Number - Region: 26-119
Classification Level Classification E-value
Superfamily POZ domain 0.0706
Family BTB/POZ domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) T1FR57
Sequence length 653
Comment (tr|T1FR57|T1FR57_HELRO) Uncharacterized protein {ECO:0000313|EMBL:ESN92674.1, ECO:0000313|EnsemblMetazoa:HelroP189564} KW=Complete proteome; Reference proteome OX=6412 OS=Helobdella robusta (Californian leech). GN=HELRODRAFT_189564 OC=Rhynchobdellida; Glossiphoniidae; Helobdella.
Sequence
MDKRIKMEIKKADDVDGSKMVVLISKTGGRFEVDEDILLRASGYFEGLVNSGMRDARFKE
LTLELMSDESLIEICEFLSKLLNDNRNNGYQCTKSKSYKMLKEGLKGASYLQICSMIHVY
NDLLSKYLSTFPRILKFASKYMLPDVLNNVREYVTENFRKLGMTSSVLKLAPDDICYLLE
SDFFNAESEFDIFNFVIRWISADESRRQHAEKLLTGVRYGLMTTGEWQRSNEILDELELN
INKKEKVVENFRSVGTIFALGSSPFKDVQPQVLSVYDFIKTFEEERKDARSDSVQFRTAN
RLGPLVPCCRYKVCMVDKCLYLAGGGIVPQRLTDEIHVFDLTDSTWTQCSKMNVPRKNFY
FGEMNGHLYAVSGRSFISLTGTVEKYVPREDRWLMSAPLPVETFNLAGCVCNGRMYVSGG
LNAHGTSKQVWRYIPDGSEWTEMAPLLNERMDHVMTTLGNRLIVIGGRKCDFDSENVMSG
EVYDSEADQWTRLLTLKKPAINSAFLNINDCLYLFGTENFESDNYFFVSSSVETFVQKIN
LSRWVLRFALNFASDGEVVREYFYICGQHLYIRGQYLYICGQYLYICGQYLYIRGQYLYI
CGQYLYICGQYFYICGQYLYICGQYLYIRGQYLYICGQYLYICAQHLYICDQF
Download sequence
Identical sequences T1FR57
XP_009028983.1.102002 jgi|Helro1|189564

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]