SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1FR69 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T1FR69
Domain Number 1 Region: 329-576
Classification Level Classification E-value
Superfamily Kelch motif 6.28e-51
Family Kelch motif 0.0000768
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) T1FR69
Sequence length 654
Comment (tr|T1FR69|T1FR69_HELRO) Uncharacterized protein {ECO:0000313|EMBL:ESN92750.1, ECO:0000313|EnsemblMetazoa:HelroP189601} KW=Complete proteome; Reference proteome OX=6412 OS=Helobdella robusta (Californian leech). GN=HELRODRAFT_189601 OC=Rhynchobdellida; Glossiphoniidae; Helobdella.
Sequence
MGKTEENCKLTGEIILISQTGSHHSVDKVLFHQASAYYQALINSNMKDAHFKELTLECLS
ECGLVEVKEYLSNFQIDKKEFKGQTTLTFSKIINEKSLIEVEEGLKGAHYLQINGMVAQY
LQLLLKHLKDTTWLHILDLSNRYSLDEVAEKTLDFVCENFKSLTDHPDMLLLSQNEVSYF
VESDLINAHSEIDIFNFVIKWISYDDSRKYCAEELLAKIRYSLMTVNERCESSDVLDKMN
ICFQHVEHNARLRNTVGVALALGGFTQKEFSTNRFQLLPLDNLLKACECNRNLDESEQTS
PESNNDKSGCMRTRCSNNGSVVFRSNKKQKLPNTLCEHGACVIDNCLYVAGGQEHYCTDG
RYTTNKVYVFNPVHSIWSQCSKMHVPRSLFYLGELAGHMYAVSGYTAPNTDTPTVEKYIP
TEDRWCMLAPLPVRVHELAGCVRAGKLYVSGGFRGPDSGHVDLVWSYDPARDEWCSMTPL
LTARSYHAMTSVGSKLVVVGGVRYLGDDTFKDLMDGEIFDFETSQWTTMLRLKMPACCSP
YLLIDNCLYLFGGHSFEDSVDHNYIQKINLSKYTKETTVNACSSITDIDTCKSAEFNNYM
YHLLDDDTKRRRTTCVDDDGDDVDCKTYKYEAQRIFYFSICIMNLTKRFVGQFR
Download sequence
Identical sequences T1FR69
XP_009029052.1.102002 jgi|Helro1|189601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]