SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1FRY1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T1FRY1
Domain Number 1 Region: 210-255,302-368
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.4e-17
Family Spermadhesin, CUB domain 0.0036
Further Details:      
 
Domain Number 2 Region: 107-209
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000103
Family Spermadhesin, CUB domain 0.0047
Further Details:      
 
Weak hits

Sequence:  T1FRY1
Domain Number - Region: 21-87
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000484
Family Spermadhesin, CUB domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) T1FRY1
Sequence length 390
Comment (tr|T1FRY1|T1FRY1_HELRO) Uncharacterized protein {ECO:0000313|EMBL:ESO10114.1, ECO:0000313|EnsemblMetazoa:HelroP190381} KW=Complete proteome; Reference proteome OX=6412 OS=Helobdella robusta (Californian leech). GN=HELRODRAFT_190381 OC=Rhynchobdellida; Glossiphoniidae; Helobdella.
Sequence
MAGIRFATNTNDFLINFNKLDNNYKITIQLSPFSLLDSNQAKLGILEIRNGASGKSPVMF
RESKLVDFLMKNTSGNEARIRFVLFNTSTPTNVQAINIVVTIQFPTCNAEYHSQTGIIQT
SDWSNLSPLFERCNLIVKVQNGYHVILNFSDVFSLSLCNSTYDTLTIRSGKFFESYCRSP
GTIILPENEAHISYTIGSPSRGFFLKFSSGCGANFSAESGVIYSPGYPENYINNLSCVYY
INVEKIILIRYKNDEFFVPESRVQAIYNYNRYPTRTSLYGSGLLPPHYQDIYMRNWRWPQ
PYQVTYTNTCPKDYLLVQELSGGRSEKLCGVQNDENMNVLKFQGPLMLNFVSDASFNDKG
FKIHYQSVGTLHLAFSIFYMHLHSFKCTFL
Download sequence
Identical sequences T1FRY1
jgi|Helro1|190381 XP_009011928.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]