SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1FS19 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T1FS19
Domain Number 1 Region: 298-478
Classification Level Classification E-value
Superfamily Kelch motif 2.22e-50
Family Kelch motif 0.00013
Further Details:      
 
Domain Number 2 Region: 171-320
Classification Level Classification E-value
Superfamily NHL repeat 0.0000149
Family NHL repeat 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) T1FS19
Sequence length 607
Comment (tr|T1FS19|T1FS19_HELRO) Uncharacterized protein {ECO:0000313|EMBL:ESO09464.1, ECO:0000313|EnsemblMetazoa:HelroP190504} KW=Complete proteome; Reference proteome OX=6412 OS=Helobdella robusta (Californian leech). GN=HELRODRAFT_190504 OC=Rhynchobdellida; Glossiphoniidae; Helobdella.
Sequence
MQYVLLMLALPFFDASGQVSPDFNLTEQPLCRLVVSWLLEQNIDKTSDEQLRFFLFLNPD
NKLIDCSEELPDRKLNNSNIVKDYKKKCSKKPSLKDKRNSLQHQRQNSSSGTKSPQPPLH
QSEDEDDVSTSMVASAVVADKSFICLAVLDQRLVSVSIKFQSDENVRKMSSGDDDNTTDE
VIMTVDRNQPQCLMTHLSSMSTARCGFGVGVANGNIIAVGGYDRGECFNTAEIYSPITNL
WCPIKPMSTLRGRFSASMLNGKLYACGGSNGTNELNSIEAYDVASDTWINVPDMAIRRSG
AGVAVCGNKLFVVGGLCGSKTLSSCEMYDPAANKWTNVANLSTGRSQAAVCSYGETSIVA
LGGCDAWNFMNTCECYDPLTDTWSFLPSLVVARRGAGAAYFKGMLFVVGGSNEQTTLTSV
EIFDPDNNCWFAGPSLGIPRSIMGVTVLEGNRLFVIGGFSGKNFLKSLECLSYDSDEFCS
YLPAGSDIESIMRADSIRKFKFQNCMSSRSSHTSSTYSDSPKSPQLDDVANTVTRNINSD
SEISSSCSLEDLNKDYHFNHHSTTSSAFGDNKMVNGTAAAAASSLAGDASLSNGGGCGEI
SGNHVDL
Download sequence
Identical sequences T1FS19
XP_009012557.1.102002 jgi|Helro1|190504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]