SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1FSS2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  T1FSS2
Domain Number - Region: 95-148
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0144
Family Spermadhesin, CUB domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) T1FSS2
Sequence length 528
Comment (tr|T1FSS2|T1FSS2_HELRO) Uncharacterized protein {ECO:0000313|EMBL:ESO06908.1, ECO:0000313|EnsemblMetazoa:HelroP191240} KW=Complete proteome; Reference proteome OX=6412 OS=Helobdella robusta (Californian leech). GN=HELRODRAFT_191240 OC=Rhynchobdellida; Glossiphoniidae; Helobdella.
Sequence
MYVKKVQQYCFPWHFNASCGPDEMIMMTSAMYGRSSKGRCSGRRSCHVVTPDPILYQLKP
CPNDFSVSLEADYSCVKVEMGKPYTCNHFGDPQIVNEPRGYLASLVVEELKIGGPRCPWM
ITASRGQQINFTLHDYGVALRRDDVISIQTMASPQSLIRHENELHLLQAYHDARHRTRRN
QLEHAPSCKVYVTLRDVEARSANSAIIDVADCTSKERIRHVMLSEGPKVEVTMMDLKVKE
EIIYYALHFEAVGCADPIVPRGAHLRRNGIQATITCNFTIQSWHIVCQGDGWYGSVDNCT
VETPTKSSMVLNDSTEIYPLDYKNKGGGTIKAGSTSVDALGHVEVVVPNDLEGGGLSLLV
AVMVGLVLGVLIGVVLLTLVLSCHKKLYSKKRLREAKELSSQRVLYSTRRDVINDNDDDN
YNADSNNINNYAPTTTSTPNYHHLHTNNNNTNNNTTSTTTYCPSYHYSPGNGFGSTGSTL
LAGRNYLDFQDGIRYTHVCGLGAMDVVPPCERNESNNNNVCNDNRQAS
Download sequence
Identical sequences T1FSS2
XP_009015004.1.102002 jgi|Helro1|191240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]