SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1FSY6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T1FSY6
Domain Number 1 Region: 35-450
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 9.29e-56
Family Integrin alpha N-terminal domain 0.00000712
Further Details:      
 
Weak hits

Sequence:  T1FSY6
Domain Number - Region: 450-508
Classification Level Classification E-value
Superfamily Integrin domains 0.000319
Family Integrin domains 0.0068
Further Details:      
 
Domain Number - Region: 582-643
Classification Level Classification E-value
Superfamily Integrin domains 0.00068
Family Integrin domains 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) T1FSY6
Sequence length 663
Comment (tr|T1FSY6|T1FSY6_HELRO) Uncharacterized protein {ECO:0000313|EMBL:ESO05207.1, ECO:0000313|EnsemblMetazoa:HelroP191408} KW=Complete proteome; Reference proteome OX=6412 OS=Helobdella robusta (Californian leech). GN=HELRODRAFT_191408 OC=Rhynchobdellida; Glossiphoniidae; Helobdella.
Sequence
MILTTNEKIPMRHLRDFKISLLIFFLEYFWDTECFNLDVSSATLKRGPPGSYFGYSITPH
KVGHHNSDIIFLVGAPRDNASDPLFSNISRPGVLYNCSFHDENTDCTPLPSFREFVLKDE
DYNDQWFGGVVVSQNIPSGQALACGHKYGKVSSARSETPGWCISLTNNLKPFKFHSPCNL
KHGGYFDYAVCQAGVSAFIDKDGEILLGAPGAHLWRGVVFGGNLRNELDGEEGMSISTSH
NMAKQGRKVYVVGAPRSDNVGEVLLLQKVHAHTFLVKVRLKGQQMGSRFGHKVLVIDVNG
DGYKLDDLVVGAPLYHGVDSCGGAIYVYMSTKATSTASTDQTKNFHDPWFGSDIVSLGDL
DRDDFNDFAVGSPYEGRGRVYIFRGGITGPQHQPSQIIEPSSFQHLFNLSFSSFGFSLAS
NGFDLDSNLHPDLLIGSYLSDAVVLLRSSPVIDIRVSIKNEPKLINPNVNVCGNDKMRGR
NDGVGCFVMRLCFNYYFRKMRKSGKLVLMSHLKSNNSAKHNSSINDSVSQAYFKFYVEKA
NTTPEKLPTAETFSTSSQAPQMKLFNKTTTASSQIIVHTTAKENKDNGNLNCVSHDVYLE
QDNHDYQNGINFHLSYELISFTPLNSSSSSHSHLNPVLSVESSRGLTHVRRSQGELRDPT
PSL
Download sequence
Identical sequences T1FSY6
jgi|Helro1|191408 XP_009016522.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]