SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1FTU2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T1FTU2
Domain Number 1 Region: 101-145
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000419
Family EGF-type module 0.009
Further Details:      
 
Domain Number 2 Region: 60-99
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000318
Family EGF-type module 0.046
Further Details:      
 
Weak hits

Sequence:  T1FTU2
Domain Number - Region: 22-57
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00243
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 147-186
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0255
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 218-246
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0269
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 189-219
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0419
Family EGF-type module 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) T1FTU2
Sequence length 303
Comment (tr|T1FTU2|T1FTU2_HELRO) Uncharacterized protein {ECO:0000313|EMBL:ESO01432.1, ECO:0000313|EnsemblMetazoa:HelroP192336} KW=Complete proteome; Reference proteome OX=6412 OS=Helobdella robusta (Californian leech). GN=HELRODRAFT_192336 OC=Rhynchobdellida; Glossiphoniidae; Helobdella.
Sequence
MNEPLRCSCPADRYGRHCDFFNSCSSTPCLATRNCSLIDPSYTCPCTINSGNSRCETFAT
PCPSTSNICSNQGSCYINASSLSSYCVCSPGFSGVSCNVVVDPCSSNPCLNGGQCKGVDR
KVDPTGRTCFCTVGFVGETCQLSVQSVCASNPCQFNSICSGLYDPVAKNLSYNCTCGQYL
EGMNCGNCTYCLNGGKCYVEAGQLKCSCSSAGKFGVRCNETDPCASAPCPAGSICQSSAD
GRYACSNNVPLAAVTSTSKQQNRSSSSCNNNITSRNCSSRNKNDNSSYDNNDKNGGRYTN
NNN
Download sequence
Identical sequences T1FTU2
jgi|Helro1|192336 XP_009020668.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]