SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1FWL8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T1FWL8
Domain Number 1 Region: 278-478
Classification Level Classification E-value
Superfamily vWA-like 1.59e-36
Family Integrin A (or I) domain 0.0022
Further Details:      
 
Domain Number 2 Region: 123-273
Classification Level Classification E-value
Superfamily vWA-like 9.05e-31
Family Integrin A (or I) domain 0.0013
Further Details:      
 
Domain Number 3 Region: 85-126
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000272
Family EGF-type module 0.016
Further Details:      
 
Weak hits

Sequence:  T1FWL8
Domain Number - Region: 19-73
Classification Level Classification E-value
Superfamily vWA-like 0.00289
Family Integrin A (or I) domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) T1FWL8
Sequence length 499
Comment (tr|T1FWL8|T1FWL8_HELRO) Uncharacterized protein {ECO:0000313|EMBL:ESO10330.1, ECO:0000313|EnsemblMetazoa:HelroP194961} KW=Complete proteome; Reference proteome OX=6412 OS=Helobdella robusta (Californian leech). GN=HELRODRAFT_194961 OC=Rhynchobdellida; Glossiphoniidae; Helobdella.
Sequence
MSSNFTATWQEAVRTRVANVKIVGVGQDIDMNELVAVATSAAPSTPQSNVFVASNYTTLS
DQLTNKISSAICAEFHVNELSVMLYPTDFKYCNSTSCMKGQCIEEFGGFSCKCPSTSTGT
YCERDKTRIGIIVYSDDAELSIRMNDYWIMQDLITAFKRVLYKGQKTNTASALNLLYTQA
FTSFNGDRSDVPNVAVIVTDGNSNVNPSSTVDEAIACRLAGIRLVTASIGDSVNPAEINN
IASFPLQFNTFNVSNYTLFDKLVHLVVQATCDSFNECLSNTCQPRGTCVNLFHSYQCRCQ
RFYAGLNCERYCTVRSDVVIVLDVSGSIGYLEDWYNMLISFAREIINGLDVDNDVARVAI
VAYSTDVIKTIYFNQYIGNRTKLLESLNFYHDGGTTNTQAALYTVANSVFDSNRGYRGND
NGVLKSVILLSDGESNVQAENTVPAANNLKRLGARVYSVVVGTDINYAEMERVSSNATLY
TYRMPYVSDVVRVASKLLT
Download sequence
Identical sequences T1FWL8
jgi|Helro1|194961 XP_009011576.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]