SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1FXR1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  T1FXR1
Domain Number - Region: 31-78
Classification Level Classification E-value
Superfamily Integrin domains 0.000319
Family Integrin domains 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) T1FXR1
Sequence length 148
Comment (tr|T1FXR1|T1FXR1_HELRO) Uncharacterized protein {ECO:0000313|EMBL:ESO05912.1, ECO:0000313|EnsemblMetazoa:HelroP64188} KW=Complete proteome; Reference proteome OX=6412 OS=Helobdella robusta (Californian leech). GN=HELRODRAFT_64188 OC=Rhynchobdellida; Glossiphoniidae; Helobdella.
Sequence
MTLYNVDLYIYDLSQGLAKTLGSLIFRKPVAGVWHTGVVVYGTEYFFGTQGIQFIQPGGT
ILGHTYRIHNMGKTEVPKELFEEYLRDLADDKFRYDKYHLLDHNCNTFSNEICLFLLNKH
IPDYITNLPQEFKQSPLGNFIKPLLDEI
Download sequence
Identical sequences T1FXR1
XP_009015280.1.102002 jgi|Helro1|64188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]