SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1FXR8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T1FXR8
Domain Number 1 Region: 254-420
Classification Level Classification E-value
Superfamily PHM/PNGase F 2.3e-42
Family Peptidylglycine alpha-hydroxylating monooxygenase, PHM 0.003
Further Details:      
 
Domain Number 2 Region: 100-254
Classification Level Classification E-value
Superfamily PHM/PNGase F 1.36e-34
Family Peptidylglycine alpha-hydroxylating monooxygenase, PHM 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) T1FXR8
Sequence length 470
Comment (tr|T1FXR8|T1FXR8_HELRO) Uncharacterized protein {ECO:0000313|EMBL:ESO05950.1, ECO:0000313|EnsemblMetazoa:HelroP64253} KW=Complete proteome; Reference proteome OX=6412 OS=Helobdella robusta (Californian leech). GN=HELRODRAFT_64253 OC=Rhynchobdellida; Glossiphoniidae; Helobdella.
Sequence
DAHTDNFGRLQVDKQQNYILEDAQRKNSGRNHQGPLVIKFHRSYDTCDDEDDYIIDKGTT
HLVYFNHKGPISSLDRINLMEEKVIVQRVQLLKSQIPDAPKPTDVRELVVHVDQVPVPLD
ETTYWCTVKKLPNFVDKHHIIKYEGAISKETQGIVHHLEVFNCQIPEGRDVIRYNAPCKS
MAERPKGLESCTKVLGAWAMGADYMTYPFEAGAPIGGPHMSRFVMIEVHYNNPLHISGLV
DSSGIRFYITRQLRRFDAGIMEIGLEYTDKMALPPHLPKWELHGYCIPECTEMALPSKGI
YVFSSQLHTHLTGMKIYTKHIRGGIELPELNRDDHYSPHYQEIRRLHEPVLVLPGDALVT
TCVDQTRNKDNVTLGGFSISDEMCVNYIHYYPLVNLEVCKSSVTTKSLYDFFDLMKRKFD
DDIDLENGISYNYQTIDWTREKVDMLRNFYDTAPISMQCNKSNGVKFPVN
Download sequence
Identical sequences T1FXR8
XP_009015318.1.102002 jgi|Helro1|64253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]