SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1FY17 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T1FY17
Domain Number 1 Region: 1-36
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000419
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 2 Region: 38-88
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000304
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 3 Region: 130-166
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000451
Family EGF-type module 0.011
Further Details:      
 
Domain Number 4 Region: 84-129
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000447
Family EGF-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) T1FY17
Sequence length 168
Comment (tr|T1FY17|T1FY17_HELRO) Uncharacterized protein {ECO:0000313|EMBL:ESO06495.1, ECO:0000313|EnsemblMetazoa:HelroP64941} KW=Complete proteome; Reference proteome OX=6412 OS=Helobdella robusta (Californian leech). GN=HELRODRAFT_64941 OC=Rhynchobdellida; Glossiphoniidae; Helobdella.
Sequence
NECSSSPCTNGGTCVDHIYYYKCTCPTGFTGTNCQYSIYPCRSNPCQNNGTCNDLSDLKA
SPAISNYTCSCIAGYNGSNCEFYWNKCLNNPCAYGGTCSVVKNLGPPESYSYKCSCVTGA
TGANCETALVNKCDSSPCKNGASCENKVTSFACTCVAGYVGITCESGW
Download sequence
Identical sequences T1FY17
XP_009015863.1.102002 jgi|Helro1|64941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]