SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1FZ15 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T1FZ15
Domain Number 1 Region: 90-265
Classification Level Classification E-value
Superfamily vWA-like 1.53e-25
Family Integrin A (or I) domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) T1FZ15
Sequence length 418
Comment (tr|T1FZ15|T1FZ15_HELRO) Uncharacterized protein {ECO:0000313|EMBL:ESN98652.1, ECO:0000313|EnsemblMetazoa:HelroP67485} KW=Complete proteome; Reference proteome OX=6412 OS=Helobdella robusta (Californian leech). GN=HELRODRAFT_67485 OC=Rhynchobdellida; Glossiphoniidae; Helobdella.
Sequence
VNLTQSTVHVPTNVYDESASVLNGVAFSEALDDVFNSNRKSFSTISWQFYCSFVGFFRIY
PGISWGNSDEADQFDCRTRLWYIQAATSSKDVIILVDTSGSMTGLRIEIAKSTVIKILDT
FNEDDYFNVISFSDEPDYFEPCYNNSLVQATVRNKQIFTKVLCSLFTSYVVKLYKIFNIY
LKNNFNSLGSKCNKVIMLITDGSPSDFREVFEKYNFPDKKVRVFTYLIGREIRDTTQLKW
MACNNKGQLMCYFSHISTLADVYEHVQDYIRVLSRPLVIGRYPQKVWTNIYGNERTNELT
TTVAMPVYDIKNASYNDGNLLGVIGTDMLLDVLTNVLPKHQLGVQNYPFAITNNGFIIFH
PDHRPYHNGKLKPNYNNLDISEVEFIDDGKIRQSMVKGETGKTRLRVKVALDEMVTHE
Download sequence
Identical sequences T1FZ15
XP_009022577.1.102002 jgi|Helro1|67485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]