SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1G054 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T1G054
Domain Number 1 Region: 355-417
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000122
Family Ovomucoid domain III-like 0.0062
Further Details:      
 
Domain Number 2 Region: 145-205
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000136
Family Ovomucoid domain III-like 0.0052
Further Details:      
 
Domain Number 3 Region: 77-139
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000749
Family Ovomucoid domain III-like 0.0051
Further Details:      
 
Domain Number 4 Region: 207-274
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000236
Family Ovomucoid domain III-like 0.0065
Further Details:      
 
Domain Number 5 Region: 529-596
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000236
Family Ovomucoid domain III-like 0.0085
Further Details:      
 
Domain Number 6 Region: 741-808
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000137
Family Ovomucoid domain III-like 0.0045
Further Details:      
 
Domain Number 7 Region: 280-350
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000887
Family Ovomucoid domain III-like 0.0086
Further Details:      
 
Domain Number 8 Region: 1-34
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000208
Family Ovomucoid domain III-like 0.0045
Further Details:      
 
Domain Number 9 Region: 632-676
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000114
Family Laminin-type module 0.0068
Further Details:      
 
Domain Number 10 Region: 685-722
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000474
Family Laminin-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) T1G054
Sequence length 810
Comment (tr|T1G054|T1G054_HELRO) Uncharacterized protein {ECO:0000313|EMBL:ESN91329.1, ECO:0000313|EnsemblMetazoa:HelroP70359} KW=Complete proteome; Reference proteome OX=6412 OS=Helobdella robusta (Californian leech). GN=HELRODRAFT_70359 OC=Rhynchobdellida; Glossiphoniidae; Helobdella.
Sequence
VCGSDGRSYKNECYLKKQACEMQQNIHIKFQGPCGKQLIIFFETLLQYIVALHYFIILNI
FSSAVTFNIHADPCENVKCHYGSSCVAGSCRCQFACSDDEDDGKKVCGSDGRSYKNECYL
KKQACEMQQNIHIKFQGPCDPCENVKCHYGSSCVAGLCQCQLVCSDDDSKKVCGSDGRSY
KNECYLKKQACEMQQNIHIKFQGPCEVTCSFGSTCIVEIARLTSCQCFFNCFDASNSSKQ
VCGSDGKSYNNECELRKHVCEEQVDIFVKSFGPCGLCNACEKKICYHGSVCVTGLNGSAE
CQCSFNCLHDRDDMKICGSDGRSYKNECELKKHACEMKKDLYVYASGPCDPCENVVCHHG
AVCKNASCHCTFDCPDDNNESKIVCGSDGRTYKNECQLKRLACENKRNISLRYNDHCDKC
LGVVCYYGAVCKDGKCQCVDQCDHSNDLLSTILFCDRSSGITYTRCTLKHAECLKGSHID
VDDGPCQTYSPITTSAVVSTSRPDTTSTTAALITTTTRSEGSGSGKGDCSKETCKFGGKC
GVNKEGKYSCICQFNCGALRSPVCGSDRQTYANECEMREYSCIKQVFLYVERDGNCAGQA
ADYNCMTSTYGCCSDGSTLAAGPDQLGCPGKCNCNKLGSYNASCQPVTLQCFCRPHVVGV
QCDRCNANYWGMHNIQHSNEGCLPCHCNQYGSKRLDCDQNSGQCLCLNGVMGHKCDICSN
GKKLSQYGCVGKQVSSRFFDVHCKFGARCHVGVHGPECVCDDNCAPDDKYGYGGVCGSDN
HWYASKCRLEMAACRKQIDIRVLYNGPCDG
Download sequence
Identical sequences T1G054
XP_009030123.1.102002 jgi|Helro1|70359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]