SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1G087 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T1G087
Domain Number 1 Region: 24-171
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.54e-27
Family Legume lectins 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) T1G087
Sequence length 171
Comment (tr|T1G087|T1G087_HELRO) Uncharacterized protein {ECO:0000313|EMBL:ESN91391.1, ECO:0000313|EnsemblMetazoa:HelroP70577} KW=Complete proteome; Reference proteome OX=6412 OS=Helobdella robusta (Californian leech). GN=HELRODRAFT_70577 OC=Rhynchobdellida; Glossiphoniidae; Helobdella.
Sequence
MDDESTKNTFSTTQPDRIKQLYPMVDECETPLPRQWSSKKNEKCPSLGLSNNDLRVFYKG
TGKDVKDAASIRTTHSIPVTCGIYYFEVKVITKGREGYMGVGVTAVQKMENRLPGWDKNS
FGYHGDDGNSFCSSGQGQPYGPTFSTGDVIGCCVNFIDNTCFYTLNGDNLG
Download sequence
Identical sequences T1G087
XP_009030156.1.102002 jgi|Helro1|70577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]