SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1G1P6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T1G1P6
Domain Number 1 Region: 37-95
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000391
Family Laminin-type module 0.041
Further Details:      
 
Domain Number 2 Region: 156-197
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000053
Family Laminin-type module 0.032
Further Details:      
 
Domain Number 3 Region: 93-143
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000335
Family Laminin-type module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) T1G1P6
Sequence length 206
Comment (tr|T1G1P6|T1G1P6_HELRO) Uncharacterized protein {ECO:0000313|EMBL:ESO08774.1, ECO:0000313|EnsemblMetazoa:HelroP74310} KW=Complete proteome; Reference proteome OX=6412 OS=Helobdella robusta (Californian leech). GN=HELRODRAFT_74310 OC=Rhynchobdellida; Glossiphoniidae; Helobdella.
Sequence
VTSSSLSTSSSSSPSSSSSSTFTRRLSLSDVVILARCMCNGHASACLPNSSSSSICQCEH
NTMGDECNACKPFYQDRPWRRGDLEDSHECQVCSCHSHSHRCRFNADLYRISGLKSGSLC
IGCKHNTAGKHCHHCKIGYHRNQKLKIESAFACIKCDCHVIGSRDPICDHVTGQCTCKTG
VGGLRCDVCLEGYVQTKSPVNPCLSW
Download sequence
Identical sequences T1G1P6
XP_009012796.1.102002 jgi|Helro1|74310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]